DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and GRF6

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001190276.1 Gene:GRF6 / 830909 AraportID:AT5G10450 Length:273 Species:Arabidopsis thaliana


Alignment Length:258 Identity:166/258 - (64%)
Similarity:206/258 - (79%) Gaps:13/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RENNVYKAKLAEQAERYDEMVEAMKKV---ASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65
            |:..||.||||||||||:|||:.|:::   |:...|||||||||||||||||||:.||:|||::|
plant     7 RDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSS 71

  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHR 130
            ||||||::..:|.:.::|.||.:||.||..:||.||.:|:.||||.|.:.||||||.||||||||
plant    72 IEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHR 136

  Fly   131 YLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLA 195
            |:|||.:|.:||.|||::::|||||.|||..|:.|||||||||||||||||||||||.|:||.:|
plant   137 YMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMA 201

  Fly   196 KAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQIQDVED 258
            |.||::||||||||.||||||||||||||||||||||||||..::          ..|:|:::
plant   202 KQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQTNQM----------HHIRDIKE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 159/231 (69%)
GRF6NP_001190276.1 14-3-3 7..242 CDD:295170 162/234 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 345 1.000 Domainoid score I232
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I579
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 1 1.000 - - otm2776
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.