DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and ywhag

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001072309.1 Gene:ywhag / 779762 XenbaseID:XB-GENE-951350 Length:247 Species:Xenopus tropicalis


Alignment Length:249 Identity:158/249 - (63%)
Similarity:193/249 - (77%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65
            |.:||..|.||:|||||||||:|..|||.|..::..|:.|||||||||||||:||||:|||:|:|
 Frog     1 MVDREQLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISS 65

  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIP-CA-TSGESKVFYYKMKGDY 128
            ||||....|.|:|:||::.||.::||||..:|.|:|::|:..||. |: |..||||||.||||||
 Frog    66 IEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNFLIKNCSETQYESKVFYLKMKGDY 130

  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193
            :|||||.|||..|....|:|..||..|.:|:...:.||||||||||||:|||||||.|:|::||.
 Frog   131 YRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACH 195

  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247
            |||.||||||||||||:|:||||||||||||||||||||||.|    |.:.|:|
 Frog   196 LAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQ----DDDGGEG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 150/230 (65%)
ywhagNP_001072309.1 14-3-3_gamma 2..247 CDD:206760 157/248 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.