DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and ywhaq

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001025570.1 Gene:ywhaq / 594958 XenbaseID:XB-GENE-946182 Length:246 Species:Xenopus tropicalis


Alignment Length:239 Identity:154/239 - (64%)
Similarity:193/239 - (80%) Gaps:2/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67
            :|...:.||||||||||||:|..:||.|.....||:.|||||||||||||:||||::||:|:|||
 Frog     2 DRNAQIQKAKLAEQAERYDDMAASMKAVTECGTELSSEERNLLSVAYKNVVGARRSAWRVISSIE 66

  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132
            ||.:::  |.||::.:.|:.:||.||::||..:||:|:||||..:|:.||:|||.||||||:|||
 Frog    67 QKSDSE--ETKLKIAREYKEKVESELQNICETVLNLLDKHLISSSTATESQVFYLKMKGDYYRYL 129

  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197
            ||.|||.:|....::|..||:.|.||:..|:.||||||||||||||||||||||||::||.|||.
 Frog   130 AEVATGDNRTKTIQDSQAAYQEAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPEKACTLAKN 194

  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVD 241
            |||:||||||||:||||||||||||||||||||||||...::.|
 Frog   195 AFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDTACDDND 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 150/228 (66%)
ywhaqNP_001025570.1 14-3-3 9..229 CDD:365974 148/221 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.