DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and ywhaqb

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_958892.1 Gene:ywhaqb / 335195 ZFINID:ZDB-GENE-030131-7135 Length:245 Species:Danio rerio


Alignment Length:245 Identity:161/245 - (65%)
Similarity:195/245 - (79%) Gaps:7/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67
            :|...:.||||||||||||:|...||.|.....||:.|||||||||||||:||||::||:|:|||
Zfish     2 DRTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWRVISSIE 66

  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132
            ||.|  |.::||:|:|.||.:||.||||||:|:|.:|.|:||..:::.||||||.||||||:|||
Zfish    67 QKTE--GNDKKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLKMKGDYYRYL 129

  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197
            ||.|.|.|:|...|||..||:.|.||:..::.||||||||||||||||:|||||||::||.|||.
Zfish   130 AEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQ 194

  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247
            |||:||||||||:||||||||||||||||||||||||..     |:.|:|
Zfish   195 AFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNA-----PDEGEG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 155/228 (68%)
ywhaqbNP_958892.1 14-3-3_theta 1..234 CDD:206759 158/238 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.