DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and ywhabl

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_955856.1 Gene:ywhabl / 321729 ZFINID:ZDB-GENE-030131-448 Length:245 Species:Danio rerio


Alignment Length:250 Identity:161/250 - (64%)
Similarity:200/250 - (80%) Gaps:10/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67
            ::...|.||||||||||||:|..|||.|...|:||:.|||||||||||||:||||:|||:::|||
Zfish     2 DKSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSIE 66

  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132
            ||.|  |:::|.:|:|.||.::||||::||:|:|.:|:|:|||.||..||:|||.||||||.|||
Zfish    67 QKME--GSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATPAESRVFYLKMKGDYFRYL 129

  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197
            ||.|.|.::.....||..|||.|.:|:..::.||||||||||||||||||||||||::||:|||.
Zfish   130 AEVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKT 194

  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKEQ 252
            |||:||||||:|:||||||||||||||||||||||||        |.|:||..|:
Zfish   195 AFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSD--------NQGEGEDAEE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 153/228 (67%)
ywhablNP_955856.1 14-3-3 2..230 CDD:295170 153/229 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.