DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and LOC298795

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001013963.1 Gene:LOC298795 / 298795 RGDID:1359510 Length:248 Species:Rattus norvegicus


Alignment Length:254 Identity:146/254 - (57%)
Similarity:187/254 - (73%) Gaps:10/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67
            ||.:.:.|||||||||||::|...||.......||:.|||||||||||||:|.:|::||:::|||
  Rat     2 ERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSFEERNLLSVAYKNVVGGQRSAWRVLSSIE 66

  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132
            ||...:|:|||...:|.||.:||.|||.:|..:|.:|:.|||..|...||:|||.||||||:|||
  Rat    67 QKINEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGEAESRVFYLKMKGDYYRYL 131

  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197
            ||.|||.|:|...:::..||:.|.||:..::|||:|||||||||||||:|||.|.|:.|..|||.
  Rat   132 AEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANRPEEAISLAKT 196

  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGD--GEPKEQIQ 254
            .||:|:|:|.||||:||||||||||||||||||||::        |||:  ||..|:.|
  Rat   197 TFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTAE--------NAGEEGGEAPEEPQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 137/228 (60%)
LOC298795NP_001013963.1 14-3-3 1..234 CDD:295170 139/239 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.