DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and Ywhah

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_037184.1 Gene:Ywhah / 25576 RGDID:3978 Length:246 Species:Rattus norvegicus


Alignment Length:249 Identity:157/249 - (63%)
Similarity:191/249 - (76%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65
            |.:||..:.:|:|||||||||:|..|||.|..::..|:.|:|||||||||||:||||:|||:|:|
  Rat     1 MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISS 65

  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCAT--SGESKVFYYKMKGDY 128
            ||||....|.|:|||.:|.||.::||||..:|:|:|.:|:|.||....  ..||||||.||||||
  Rat    66 IEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDY 130

  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193
            :|||||.|:|..:....|.|..|||.|.:|:...:.||||||||||||||||||||.|:|::||.
  Rat   131 YRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACL 195

  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247
            |||.||||||||||||:|:||||||||||||||||||||||.|.||    ||:|
  Rat   196 LAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEE----AGEG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 147/230 (64%)
YwhahNP_037184.1 14-3-3_eta 3..241 CDD:206761 151/237 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.