DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and M117.3

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_502236.1 Gene:M117.3 / 187477 WormBaseID:WBGene00010919 Length:125 Species:Caenorhabditis elegans


Alignment Length:125 Identity:47/125 - (37%)
Similarity:68/125 - (54%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSP 188
            |..|:.|||.:: ...:|::.|..|.|||:.|..||.:.:.||||||||||||.|...:::||.|
 Worm     1 MVADHFRYLVQY-DDINREEHAHKSRIAYQEALGIAKDKMQPTHPIRLGLALNASALNFDVLNLP 64

  Fly   189 DRACRLAKAAFDDAIAELDTL--SEESYKDSTL-----IMQLLRDNLTLWTSDMQAEEVD 241
            ..|..:|::|.|.|..||:.:  |.:||..|.|     :..||:..........:.||.|
 Worm    65 KEANEIAQSALDSAHRELEKMKSSLDSYDISNLKRARTLYDLLKSTHEQRVDGKEGEEAD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 44/115 (38%)
M117.3NP_502236.1 14-3-3 <1..97 CDD:382840 41/96 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S40
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.