DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and AT3G53910

DIOPT Version :10

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_190959.1 Gene:AT3G53910 / 824558 AraportID:AT3G53910 Length:108 Species:Arabidopsis thaliana


Alignment Length:84 Identity:29/84 - (34%)
Similarity:50/84 - (59%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 YAGARFAGSLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGKNGVQENL-----GLPKLNDYE 312
            ||...|..||::.|:|:.:|.:.::|.|:|||..:|:|...:||..::|.:     ||.|   ||
plant     9 YAMISFLKSLIRALDGDDDVFDFAFVASSVTELPYFATRTKIGKKRIEEVIDSDLQGLAK---YE 70

  Fly   313 KKLLEAAIPELKKNIQKGI 331
            ::.::|..|.:|..|:|.|
plant    71 ERAIKAIKPRVKVTIEKDI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 29/84 (35%)
AT3G53910NP_190959.1 PLN00106 <9..87 CDD:215058 27/80 (34%)

Return to query results.
Submit another query.