DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and mdh1b

DIOPT Version :9

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_009303919.1 Gene:mdh1b / 767794 ZFINID:ZDB-GENE-060929-384 Length:471 Species:Danio rerio


Alignment Length:258 Identity:47/258 - (18%)
Similarity:86/258 - (33%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KQLALQGVRTFSVGQQNNYKVTVCGAAGGIGQPLSL-LLKQNPLVTDLALYDIVH---------- 60
            |.:.|.|...|....|..|.:|     ..:...|.| :.::|....:|.:.:.||          
Zfish    75 KGMLLGGFSDFLEHAQGYYNIT-----SDMNSDLMLKIAEENQATKELCMEEEVHRLKSLRPLHI 134

  Fly    61 ------------------TPGVAADLS----HI-DTKSKTAGFIGADQLGDSLKGSDVVVIPAGV 102
                              |||:.:.|.    |: ||.       |::::..:||   :..:...:
Zfish   135 WISSALNPVCYSLIPHLFTPGLFSGLPIFSLHLMDTS-------GSEEMLQALK---METVDLAI 189

  Fly   103 PRKPGMT-----------------RDDLFNVNAGIIKDISN---SIAKNCPKALVAIITN-PVNT 146
            ||...:|                 .||  ...||...|..|   .:|::..:....|.|| ..:.
Zfish   190 PRLHEVTIHSDQMLAFQEAHFIIFLDD--QQPAGEYNDEQNDKDQVAEHFHRYGQLIETNAQKDV 252

  Fly   147 CVPIAAE---------ILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQTVQIPVIGGH 200
            .|.:|.:         :::.|...||:....::|.....||..:...|.|....:...::.|:
Zfish   253 RVLVAGDFFINMKCSLLIENAPSIDPRNFVAMTTQLEYEARTQLAQKLSVKTSDITNVIVWGN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 42/240 (18%)
mdh1bXP_009303919.1 NADB_Rossmann 9..463 CDD:304358 47/258 (18%)
MalateDH-SF1 131..463 CDD:130820 34/197 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.