DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and UEVLD

DIOPT Version :9

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001035787.1 Gene:UEVLD / 55293 HGNCID:30866 Length:471 Species:Homo sapiens


Alignment Length:295 Identity:60/295 - (20%)
Similarity:105/295 - (35%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVTVCGAAGGIGQPLSLLLKQNPLVTDLALYDIVH-TPGVAADLS-------------HIDTKSK 76
            |:||.| .|.:|...:|.:....:...|.|.|:.. |.|...||.             .....||
Human   184 KITVVG-GGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSK 247

  Fly    77 TAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKALVAIIT 141
            ...|. .:.||.|....|||                  ..|..:.:.:..::......:::.:.:
Human   248 VVIFT-VNSLGSSQSYLDVV------------------QSNVDMFRALVPALGHYSQHSVLLVAS 293

  Fly   142 NPVNTCVPIAAEILKKAGVYDPKRLFGVS-TLDVVRARAFIGHALGVDPQTVQIPVIGGHSGVTI 205
            .||.    |...:..|...:...|:.|:. .||..|.:..|.:.|.......::.|||......:
Human   294 QPVE----IMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKV 354

  Fly   206 LPVLSQSQPLFKGNQDTIEKLT-VRIQEAGTEVVKAKAGAGSATLSMAYAGARFAGSLLKGLNGE 269
            |        .:.|.::.:...: |::.....|:::.|   |..:.|:..:.|....|:   :|.:
Human   355 L--------TWSGQEEVVSHTSQVQLSNRAMELLRVK---GQRSWSVGLSVADMVDSI---VNNK 405

  Fly   270 KNVIECSYVQS---TVTEATFFSTPLVLGKNGVQE 301
            |.|...|.:..   .:....|.|.|.:||.|||.|
Human   406 KKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 60/295 (20%)
UEVLDNP_001035787.1 UEV 21..138 CDD:283415
PLN02602 161..471 CDD:178212 60/295 (20%)
LDH_1 180..468 CDD:133429 60/295 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.