DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and Uevld

DIOPT Version :9

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001035785.1 Gene:Uevld / 54122 MGIID:1860490 Length:471 Species:Mus musculus


Alignment Length:345 Identity:71/345 - (20%)
Similarity:116/345 - (33%) Gaps:103/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKQVTKQLALQGVRTFSVGQQNNY------KVTVCGAAGGIGQPLSLLLKQNPLVTDLAL---- 55
            :|..:||  ..:||...:.....|:      |:||.| :|.:|...:|.:....:...|.|    
Mouse   155 LLAYITK--ITEGVSDINSRGWTNHENKILNKITVVG-SGDLGIACTLAISAKGIADKLLLLDLS 216

  Fly    56 ---------YDIVHTPGV--AADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMT 109
                     .||.:.|.|  :.||| ....||...|     ..:||.||:..:            
Mouse   217 DGMSQGTMDLDIFNLPNVEISKDLS-ASAHSKVVIF-----TANSLGGSESYL------------ 263

  Fly   110 RDDLFNVNAGIIKDISNSIAKNCPKALVAIITNPVNTCVPIAAEILKKAGVYDPKRLFGVS-TLD 173
              .....|..:.:.:..::......|::.:.:.||.    |.:.:..|...:...|:.|:. .||
Mouse   264 --HAVQSNVDMFRALVPALGHYSQHAVLLVASQPVE----IMSYVTWKLSTFPATRVVGIGCNLD 322

  Fly   174 VVRARAFIGHALGVDPQTVQIPVIG-----------GHSGVTILPVLSQSQPLFKGNQDTIEKLT 227
            ..|.:..|...|.|.....::.|:|           |..||  |...||:|              
Mouse   323 SQRLQYIITSVLKVQTSGKEVWVVGEQGENKVCSWSGRDGV--LSPSSQAQ-------------- 371

  Fly   228 VRIQEAGTEVVKAKAGAGSATLSMAYAG-----------ARFAGSLLKGLNGEKNVIECSYVQST 281
              :.....|::|.| |..|.::.::.|.           .....:|.||..|..|.:        
Mouse   372 --LSSRAMELLKVK-GQRSWSVGLSVADLVDTIINNKRKVHSVSTLAKGYYGLDNEV-------- 425

  Fly   282 VTEATFFSTPLVLGKNGVQE 301
                 |.|.|.:||..||.|
Mouse   426 -----FLSLPCILGTGGVSE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 65/321 (20%)
UevldNP_001035785.1 UEV 21..138 CDD:283415
PLN02602 177..471 CDD:178212 65/321 (20%)
NADB_Rossmann 183..468 CDD:304358 65/315 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.