DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and Mdh1

DIOPT Version :9

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001303806.1 Gene:Mdh1 / 24551 RGDID:3072 Length:355 Species:Rattus norvegicus


Alignment Length:347 Identity:89/347 - (25%)
Similarity:149/347 - (42%) Gaps:55/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVTVCGAAGGIGQPL-------SLLLKQNPLVTDLALYDIVHTP------GVAADLSHIDTKSKT 77
            :|.|.||||.|...|       |:..|..|::  |.|.||  ||      ||..:|... .....
  Rat     6 RVLVTGAAGQIAYSLLYSIGNGSVFGKDQPII--LVLLDI--TPMMGVLDGVLMELQDC-ALPLL 65

  Fly    78 AGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKAL-VAIIT 141
            ...|..|:...:.|..||.|:...:||:.||.|.||...|..|.|....::.|...|:: |.::.
  Rat    66 QDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVG 130

  Fly   142 NPVNT-CVPIAAEILKKAGVYDPKRLFGVST-LDVVRARAFIGHALGVDPQTVQIPVIGGHSGVT 204
            ||.|| |:..:     |:....||..|...| ||..||::.|...|||....|:..:|.|:...|
  Rat   131 NPANTNCLTAS-----KSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSST 190

  Fly   205 ILPVLSQSQPLFKGNQDTI------------EKLTVRIQEAGTEVVKAKAGAGSATLSMAYAGAR 257
            ..|.::.::...:|.:..:            |.:|. :|:.|..|:||:      .||.|.:.|:
  Rat   191 QYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITT-VQQRGAAVIKAR------KLSSAMSAAK 248

  Fly   258 FAGSLLKGL---NGEKNVIECSYVQS----TVTEATFFSTPLVLGKNGVQENL-GLPKLNDYEKK 314
            .....::.:   ..|...:....:..    .|.:...:|.|:|: ||...:.: ||| :||:.::
  Rat   249 AISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVI-KNKTWKFVEGLP-INDFSRE 311

  Fly   315 LLEAAIPELKKNIQKGIDFANA 336
            .::....||.:..:...:|.::
  Rat   312 KMDLTAKELTEEKETAFEFLSS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 88/343 (26%)
Mdh1NP_001303806.1 MalateDH-SF1 2..327 CDD:130820 88/339 (26%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 88/340 (26%)
PTS1 353..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.