DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh2 and Mdh1

DIOPT Version :9

Sequence 1:NP_650696.1 Gene:Mdh2 / 42185 FlyBaseID:FBgn0262559 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001303604.1 Gene:Mdh1 / 17449 MGIID:97051 Length:355 Species:Mus musculus


Alignment Length:348 Identity:93/348 - (26%)
Similarity:153/348 - (43%) Gaps:57/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVTVCGAAGGIGQPL-------SLLLKQNPLVTDLALYDIVHTP------GVAADLSHIDTKSKT 77
            :|.|.||||.|...|       |:..|..|::  |.|.||  ||      ||..:|... .....
Mouse     6 RVLVTGAAGQIAYSLLYSIGNGSVFGKDQPII--LVLLDI--TPMMGVLDGVLMELQDC-ALPLL 65

  Fly    78 AGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKAL-VAIIT 141
            ...|..|:...:.|..||.|:...:||:.||.|.||...|..|.|....::.|...|:: |.::.
Mouse    66 QDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVG 130

  Fly   142 NPVNT-CVPIAAEILKKAGVYDPKRLFGVST-LDVVRARAFIGHALGVDPQTVQIPVIGGHSGVT 204
            ||.|| |:..:     |:....||..|...| ||..||::.|...|||....|:..:|.|:...|
Mouse   131 NPANTNCLTAS-----KSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSST 190

  Fly   205 ILPVLSQSQPLFKGNQDTI------------EKLTVRIQEAGTEVVKAK--AGAGSATLSMA--- 252
            ..|.::.::...:|.:..:            |.:|. :|:.|..|:||:  :.|.||..::|   
Mouse   191 QYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITT-VQQRGAAVIKARKLSSAMSAAKAIADHI 254

  Fly   253 ---YAGARFAGSLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGKNGVQENL-GLPKLNDYEK 313
               :.|......:..|:..:.|    ||   .|.:...:|.|:|: ||...:.: ||| :||:.:
Mouse   255 RDIWFGTPEGEFVSMGVISDGN----SY---GVPDDLLYSFPVVI-KNKTWKFVEGLP-INDFSR 310

  Fly   314 KLLEAAIPELKKNIQKGIDFANA 336
            :.::....||.:..:...:|.::
Mouse   311 EKMDLTAKELTEEKETAFEFLSS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh2NP_650696.1 MDH_glyoxysomal_mitochondrial 25..334 CDD:133422 92/344 (27%)
Mdh1NP_001303604.1 MalateDH-SF1 2..327 CDD:130820 92/340 (27%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 92/341 (27%)
PTS1 353..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.