DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7168 and Commd9

DIOPT Version :9

Sequence 1:NP_650695.1 Gene:CG7168 / 42184 FlyBaseID:FBgn0038586 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_083911.1 Gene:Commd9 / 76501 MGIID:1923751 Length:198 Species:Mus musculus


Alignment Length:194 Identity:48/194 - (24%)
Similarity:86/194 - (44%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLQKPASAVV-ELCKSAFDYLINGPNPSRYEMLAKKSSDLGSPEA-VQQAVEALISLLISVTTR 77
            |||:..:..|| :||:.:|    :........:|.|..|.|..|:. ..|.::||......|..|
Mouse    14 SLLKASSKDVVRQLCQESF----SSSCLDSESLLDKTCSSLSVPQGEAAQLLQALHHFTRLVAFR 74

  Fly    78 VGSSSVDMEAILRQTFPE-----LGDDVIEVLEQFVTSKRNFVEGSIKSANIRAYRLVNLDWRLE 137
            ..||:   |||| ..|||     |.:.:.:::.:.:::.|    ...::..|...|||:||||::
Mouse    75 DLSSA---EAIL-ALFPENFHQNLKNLLTKIIVEHISTWR----AEAQANQISLPRLVDLDWRVD 131

  Fly   138 VRTASRSLLDQCQVVVTMKLYLHTEPK--NENRELLAV-------------DISGRSEQELKAM 186
            ::|:|.::.........:::.:..:|.  .|...:.||             |..||...:|.|:
Mouse   132 IKTSSDNISRMAVPTCLLQMKIQEDPSLCGEKPSISAVTMELSKETLDTMLDGLGRIRDQLSAV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7168NP_650695.1 Commd 26..224 CDD:297546 43/182 (24%)
Commd9NP_083911.1 Exo70 10..>146 CDD:281124 39/143 (27%)
Commd9 90..197 CDD:240105 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.