DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7168 and Commd2

DIOPT Version :9

Sequence 1:NP_650695.1 Gene:CG7168 / 42184 FlyBaseID:FBgn0038586 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001102973.1 Gene:Commd2 / 688478 RGDID:1588810 Length:199 Species:Rattus norvegicus


Alignment Length:234 Identity:71/234 - (30%)
Similarity:113/234 - (48%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLTQQQRNHLSLLQKPASAVV-ELCKSAFDYLINGPNPSRYEMLAKK---SSDLGSPEAVQQAV 64
            |.|:::.:.||:.|.:..|||| |..:.|.::|..|.||..||..|:|   |||     .:|..|
  Rat     3 LDLSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGSNPKIYEGAARKLNVSSD-----TIQHGV 62

  Fly    65 EALISLLISVTTRVGSSSVD-MEAILRQTFPELGDDVIEVLEQFVTSKRNFVEGSIKSANIRAYR 128
            |.| :.|::.::::..|.:| .:::....|.|   ::.::|.|.....|..:...:.....|...
  Rat    63 EGL-TYLLTESSKLMISELDFQDSVFVLGFSE---ELNKLLLQLYLDNRKEIRTILNELAPRLPS 123

  Fly   129 LVNLDWRLEVRTASRSLLDQCQVVVTMKLYLHTEPKNENRELLAVDISGRSEQELKAMQEDERLH 193
            ..:|:|||:|:.|||||..|.:..||:||:|              |.||           |...|
  Rat   124 YHSLEWRLDVQLASRSLRQQMKPAVTIKLHL--------------DQSG-----------DHSTH 163

  Fly   194 RKDLLVQTDVCSLVHMIKTLEDALAESKTRRIRNIVDGI 232
                .:|||..:|:|:::.||.||.|.||...|.:|..|
  Rat   164 ----CLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRSI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7168NP_650695.1 Commd 26..224 CDD:297546 59/201 (29%)
Commd2NP_001102973.1 Commd2 26..190 CDD:240098 59/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346720
Domainoid 1 1.000 44 1.000 Domainoid score I12002
eggNOG 1 0.900 - - E1_28MHC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5142
OMA 1 1.010 - - QHG55677
OrthoDB 1 1.010 - - D1458356at2759
OrthoFinder 1 1.000 - - FOG0008101
OrthoInspector 1 1.000 - - oto96520
orthoMCL 1 0.900 - - OOG6_106223
Panther 1 1.100 - - LDO PTHR15857
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.