DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7168 and commd9

DIOPT Version :9

Sequence 1:NP_650695.1 Gene:CG7168 / 42184 FlyBaseID:FBgn0038586 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001082867.1 Gene:commd9 / 562660 ZFINID:ZDB-GENE-070424-139 Length:197 Species:Danio rerio


Alignment Length:223 Identity:50/223 - (22%)
Similarity:93/223 - (41%) Gaps:74/223 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTQQQRNHLSLLQKPAS--AVVELCKSAFDYLINGPNPS---RYEMLAKKSSD---LGSPEAVQQ 62
            :||.|...|.||.|..|  ||.::|..:|        |:   :.:.:.:|:::   :...|||| 
Zfish     4 MTQDQFTALQLLLKAPSKDAVRQICTESF--------PAGAFKSQSVVEKTANALSVSHNEAVQ- 59

  Fly    63 AVEALISLLISVTTRVGSSSVDMEAILRQTFPELGDDVIEVLEQFVTSKRNFV-----EGSIKSA 122
                |::...:::..:...::.....:...||          |.|.::.:|.:     |.|:|..
Zfish    60 ----LLTAFHTLSHHIVYHNLTSPEQILSIFP----------ESFHSNLKNLITKILLENSVKWR 110

  Fly   123 N------IRAYRLVNLDWRLEVRTASRSL----LDQC-----------------QVVVTMKLYLH 160
            |      |...:||:::||::::|||.||    :..|                 :..|||:|   
Zfish   111 NEALANQISLPKLVDMEWRVDMKTASDSLSRMAVPTCLLQMKLQDTPCISSGPSESTVTMEL--- 172

  Fly   161 TEPKNENRELL--AVDISGRSEQELKAM 186
                  ::|.|  .:|..||...:|.|:
Zfish   173 ------SKETLDTMIDGLGRIRDQLSAV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7168NP_650695.1 Commd 26..224 CDD:297546 40/201 (20%)
commd9NP_001082867.1 Commd9 90..196 CDD:240105 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.