DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7168 and COMMD2

DIOPT Version :9

Sequence 1:NP_650695.1 Gene:CG7168 / 42184 FlyBaseID:FBgn0038586 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_057178.2 Gene:COMMD2 / 51122 HGNCID:24993 Length:199 Species:Homo sapiens


Alignment Length:236 Identity:72/236 - (30%)
Similarity:118/236 - (50%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLTQQQRNHLSLLQKPASAVV-ELCKSAFDYLINGPNPSRYEMLAKK---SSDLGSPEAVQQAV 64
            |.|:::.:.||:.|.:..|||| |..:.|.::|..|.||..||..|:|   |||     .||..|
Human     3 LELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSD-----TVQHGV 62

  Fly    65 EALISLLISVTTRVGSSSVD-MEAILRQTFPELGDDVIEVLEQFVTSKRNFVEGSIK--SANIRA 126
            |.| :.|::.::::..|.:| .:::....|.|   ::.::|.|.....|..:...:.  :.::.:
Human    63 EGL-TYLLTESSKLMISELDFQDSVFVLGFSE---ELNKLLLQLYLDNRKEIRTILSELAPSLPS 123

  Fly   127 YRLVNLDWRLEVRTASRSLLDQCQVVVTMKLYLHTEPKNENRELLAVDISGRSEQELKAMQEDER 191
            |.  ||:|||:|:.|||||..|.:..||:||:|     |:|.:                      
Human   124 YH--NLEWRLDVQLASRSLRQQIKPAVTIKLHL-----NQNGD---------------------- 159

  Fly   192 LHRKDLLVQTDVCSLVHMIKTLEDALAESKTRRIRNIVDGI 232
             |...:| |||..:|:|:::.||.||.|.||...|.:|..|
Human   160 -HNTKVL-QTDPATLLHLVQQLEQALEEMKTNHCRRVVRNI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7168NP_650695.1 Commd 26..224 CDD:297546 60/203 (30%)
COMMD2NP_057178.2 Commd2 26..190 CDD:240098 60/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153117
Domainoid 1 1.000 45 1.000 Domainoid score I12277
eggNOG 1 0.900 - - E1_28MHC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5248
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55677
OrthoDB 1 1.010 - - D1458356at2759
OrthoFinder 1 1.000 - - FOG0008101
OrthoInspector 1 1.000 - - oto89394
orthoMCL 1 0.900 - - OOG6_106223
Panther 1 1.100 - - LDO PTHR15857
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5388
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.