DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non3 and RPF2

DIOPT Version :9

Sequence 1:NP_650694.2 Gene:Non3 / 42183 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_115570.1 Gene:RPF2 / 84154 HGNCID:20870 Length:306 Species:Homo sapiens


Alignment Length:303 Identity:142/303 - (46%)
Similarity:202/303 - (66%) Gaps:2/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKN 66
            :|.|:.||||::.|:.|..|||:|.|:.:..:.:.|......|...:||:.|||||...:..:||
Human     3 TLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKN 67

  Fly    67 DITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKN 131
            ...||:|.:||||.:.|:|.:||.|||.:||||:|:::||:::..||||.||||:.:.::.:.||
Human    68 ITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKN 132

  Fly   132 EKIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMR 196
            .|.....||.|:|.|..:..||:.|||::|.||.|:...|.:|||.|:|:||.||..:. .|..|
Human   133 SKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNG-KIYFR 196

  Fly   197 SYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGN 261
            ||::||||||.|||||||||:|||.|..:|||.:||:||||.:.|.||.||..||||||.|..|.
Human   197 SYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGT 261

  Fly   262 TKGRVHLGKQQTGSIQTRRVKALRKTPEEK-KENRQRKKVALK 303
            |.||:|:.||....:|||::|.|:|.|.|: .|:.::|...:|
Human   262 TYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:412658 138/286 (48%)
RPF2NP_115570.1 Brix 6..297 CDD:321259 139/291 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..306 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147895
Domainoid 1 1.000 178 1.000 Domainoid score I3595
eggNOG 1 0.900 - - E1_COG5106
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6404
Inparanoid 1 1.050 276 1.000 Inparanoid score I2970
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53948
OrthoDB 1 1.010 - - D434863at33208
OrthoFinder 1 1.000 - - FOG0005406
OrthoInspector 1 1.000 - - oto91806
orthoMCL 1 0.900 - - OOG6_102220
Panther 1 1.100 - - LDO PTHR12728
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1197
SonicParanoid 1 1.000 - - X3835
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.