DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and Mterf1

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_445951.1 Gene:Mterf1 / 85261 RGDID:621318 Length:374 Species:Rattus norvegicus


Alignment Length:267 Identity:55/267 - (20%)
Similarity:99/267 - (37%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 RELESETLTLKSLRQSLINAYLRERLQMD-DNDLQKLWRVYTRIRHKSFRAVQDTIELLTKEFNF 246
            ||:.:..|.:.::.:....::.|....:: :|:::.|..|  .:.||..      ..|||     
  Rat   124 REIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSV--GLTHKCL------CRLLT----- 175

  Fly   247 SAERLRKNSFLLYSE-----------------ADNVRRILREVPTIDSQDIREI----------- 283
            ||.|...||..|..:                 .|.||:|:.:.|:|..|..:.:           
  Rat   176 SAPRTFSNSLNLNKQMVEFLQETGISLGHNNPTDFVRKIISKNPSILIQSTKRVKTNIEFLQSTF 240

  Fly   284 GFRRPKILMSTC-----------DSLKQTLQHVH----AFGISEDA----VLRCLEVLTLGP--- 326
            ...:..:|:..|           |..|:...::.    :.|.:|:.    ||..|.::.|..   
  Rat   241 NLDKEDLLLLICGPGARILDLSNDCTKRNYTNIKKRLLSLGCTEEEVQKFVLSYLNMIFLSEKKF 305

  Fly   327 ----DTVLERLRDLQEIEEFQVLGTNPRILRLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEA 387
                |.:||     ::|...|:| .|||:|....:..|.|:|........|..:|:.:||.....
  Rat   306 NDKIDCLLE-----EKISTSQIL-ENPRVLDSSIHTLKTRIRELAHAGYDVSTSSIALLSWSQRR 364

  Fly   388 F-AKFAR 393
            : ||..|
  Rat   365 YEAKLKR 371

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
mTerf5NP_650693.1 None
Mterf1NP_445951.1 mTERF 53..366 CDD:280667 52/260 (20%)