DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and Mterf2

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_030101190.1 Gene:Mterf2 / 74238 MGIID:1921488 Length:402 Species:Mus musculus


Alignment Length:321 Identity:62/321 - (19%)
Similarity:120/321 - (37%) Gaps:82/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EIPMEEPLNASYLSKTLGSSYRSWAAALEKHPE-------LKTLKRK----------DLLSSYDT 94
            |..:||..|   :.|.||::....|:.||:.||       ....|||          :|:...:.
Mouse    91 ETYVEEIAN---ILKELGANKTVIASILERCPEAIICSPAAVNTKRKLWQMVCKNEAELVQLIEQ 152

  Fly    95 LKSLDYSVDDIIAKPMIIYYGATTLANRHSVLQECGFHNVTVQTLAKYVT----VVNKPIEVLKA 155
            .....::|.:...:.:.:.:           .||.|..||.:   ::::|    :.:.|:|..| 
Mouse   153 FPESFFTVKNQENQKLNVQF-----------FQELGLRNVVI---SRFLTTASSIFHNPVENNK- 202

  Fly   156 HNYIPFDVKVAERLAGYFKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWR 220
                        ::.|..::..|.:...|..::...||.|.|   |.::                
Mouse   203 ------------QMIGVLQESYLNLGGSEANAKVWLLKLLSQ---NPFI---------------- 236

  Fly   221 VYTRIRHKSFRAVQDTIELLTKEFNFSAERL----RKNSFLLYSEADNVRRILREVPT---IDSQ 278
                :.| |.|||.:|::.|..:....:|.|    :...||...:..:::..:....|   ....
Mouse   237 ----VLH-SPRAVGETLKCLQGQGFTDSEVLQLLSKLKGFLFQLQPGSIQNSISFTKTTFECTDY 296

  Fly   279 DIREIGFRRPKILMSTCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEI 339
            |:|::..:.|.:|......|::.:|.:...|||...:.....||.|.|..:..|:|.|..:
Mouse   297 DLRQLVVKCPALLCYPASVLEERIQALLKEGISIAQIRESPMVLELTPQIIQYRIRKLNSL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf5NP_650693.1 None
Mterf2XP_030101190.1 mTERF 75..377 CDD:388635 62/321 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.