DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and mterf2

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001038293.2 Gene:mterf2 / 557469 ZFINID:ZDB-GENE-070424-91 Length:376 Species:Danio rerio


Alignment Length:335 Identity:68/335 - (20%)
Similarity:114/335 - (34%) Gaps:103/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SVLQECGFHNVT---VQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGYFKDIKLPVDLREL 185
            |:...|....||   :|.....||....|: |:.|...:..|:....:|.|:....| ||.:   
Zfish     8 SICLYCQRAQVTPLLLQRTCSSVTQEENPL-VIDALYDLSVDISKVRKLKGWVLRQK-PVYV--- 67

  Fly   186 ESETLTLKSLRQSLINAYLRERL----------QMDDNDLQK-LWR------------------- 220
             :||:||  ||....|..:..|:          :.:..:||| ||.                   
Zfish    68 -NETVTL--LRDIGANETVIARVLELHPEAILCKPEQMELQKQLWMSVCANNKDLVGIVEKFPAS 129

  Fly   221 ---------------VYTRIRHKSFRAVQDTIELLTKEFNFSAER-------LRKNSFLLYSEAD 263
                           .|.:..|.:.|.:...:....:.|:...::       |:|....|....|
Zfish   130 FFTSSSNHDNQKANIEYFQTLHLNKRIISKLMASAPQSFSRPVKQNQEMIQTLQKTFLDLGGNED 194

  Fly   264 NVRRILREVPTIDSQDIREIGFRRPKILMSTCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDT 328
            |::..|:::.|           :.|.:|:...|:|...|..:|..|.:...:|.           
Zfish   195 NMKVWLQKLLT-----------QYPYVLLKPSDALCDNLTFLHNRGFTSGELLH----------- 237

  Fly   329 VLERLRDLQEIEEFQVLGTNPRILRLV--HYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKF 391
            :|.:||..       |...||..:||.  :.|...|...|.|.::.::|.:|...|....|    
Zfish   238 LLSKLRGF-------VTELNPESMRLTLSYSQEMFRCTEDELRRIVLQCPALLYYSVPILA---- 291

  Fly   392 ARDGSDRTKG 401
                 ||.||
Zfish   292 -----DRFKG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf5NP_650693.1 None
mterf2NP_001038293.2 mTERF 71..351 CDD:303004 50/266 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.