DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and mTTF

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_609709.1 Gene:mTTF / 34837 FlyBaseID:FBgn0028530 Length:410 Species:Drosophila melanogaster


Alignment Length:465 Identity:99/465 - (21%)
Similarity:171/465 - (36%) Gaps:148/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSYRSWAAALEKHPELKT----LKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYYGATTLANRHSV 125
            |..||:..||:.|..|..    ..|:.|.|.|:..           |.|..:....|..:|    
  Fly     4 SLLRSFETALKLHAGLNMHPMHCSRRLLFSQYENR-----------ASPSRLTSSGTLGSN---- 53

  Fly   126 LQECGFHNVTVQTLAKYVTVVNKPIEVLKAHN-YIPFDVKVAERLAGYFKDIKLPVDLRELESET 189
                                        :|.| |:|           |.:|       ||..::|
  Fly    54 ----------------------------EAENDYVP-----------YRQD-------RETGTKT 72

  Fly   190 LTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRA-----VQDTIELLTKEFNFSAE 249
                   :.|:.| ||||.:..|.:|||:  :...:.|:.:|.     |.||::|         |
  Fly    73 -------RVLLEA-LRERFRFTDAELQKI--ISDELVHRCYRGRSLTLVMDTLQL---------E 118

  Fly   250 RLRKNSFLLYS---EADNVRRILREVPTIDSQDIREIGFRRPKILMSTCDSLKQTLQHVHAFGIS 311
            .:.:.||:.|.   ..|| :|:..::..:.|.|.::|....| .|..|...|::.   |.|....
  Fly   119 GVSRRSFVEYPWLLSLDN-KRLELKMQLLKSMDFKDINHFVP-FLRLTVPRLRKL---VGALNSE 178

  Fly   312 EDA------VLRCLEVLTLGPDTVLERL---------------RDLQEIEEFQVLGTN------- 348
            .||      |....|.|.:.||.|.:.|               ::||.:.::.|...|       
  Fly   179 RDAMPQRNRVYYISEKLDVSPDIVSKYLSKRLFILEMPFEMFEKNLQHMIDYNVSPINVLKDLWA 243

  Fly   349 ----PRILRLVHYQNKARLRLDYLNQLRVRC------ASLHILSCGSEAFAKFARDGSDRTKGRD 403
                |:.::| ..:...|.:.|.:....|||      .||.:.....:...:|:          .
  Fly   244 FRYTPKSVQL-RLERAKRAKKDKIMPWMVRCPEPILQRSLKLSLDELKVLGEFS----------S 297

  Fly   404 IVVYLSNVLGKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSK-KFKLNEIFANIHLLLYPIKR 467
            :|.||::.||......:.::.:||....:.:..:|:.|:||..: :|...|:..|..:|.:.:|.
  Fly   298 VVEYLAHRLGFSTSEAKAIMDKHPQVHTVRVTKIKEVLDYLLDEAQFTRFEVAQNPRILCHSLKT 362

  Fly   468 IEEKMLLLQS 477
            .:|:|..|:|
  Fly   363 TKERMEELKS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf5NP_650693.1 None
mTTFNP_609709.1 mTERF <284..378 CDD:327630 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.