DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and Mterf1b

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001036135.2 Gene:Mterf1b / 208595 MGIID:3704243 Length:381 Species:Mus musculus


Alignment Length:345 Identity:71/345 - (20%)
Similarity:130/345 - (37%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SYRSWAAALE-KHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYYGATTLANRHSV--LQ 127
            |:|:::...: |..|....:|:||||:   |.::...:|....:...::..|.|......:  |.
Mouse    36 SFRTFSVECDSKDKESLEEEREDLLSN---LVTMGVDIDMARRRQPGVFNKAVTNEQELKIFLLS 97

  Fly   128 ECGFHNVTVQTLAKYVTVVNKPIEVLKA-----HNYIPFDVKVAERL----AGYFK---DIKLPV 180
            :.....|....:::|...:.:..|.|..     ...:..|:::...|    ..:|:   ::.|..
Mouse    98 KGASDKVIGSIISRYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLEN 162

  Fly   181 DLRELESETLTLKSLRQSLINA----------------YLRER-LQMDDND----LQKLWRVYTR 224
            :::.|.|..||.|.|.:.|.||                :|:|. :.:..||    ::|:......
Mouse   163 NIKFLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKIISKNPS 227

  Fly   225 IRHKSFRAVQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPK 289
            |..:|.:.|:..||.|...||     |.|...||.......|                       
Mouse   228 ILIQSTKRVKTNIEFLQSTFN-----LNKQDLLLLICGPGAR----------------------- 264

  Fly   290 ILMSTCDSLKQTLQHVH----AFGISEDA----VLRCLEVLTLGPDTVLERLRDL--QEIEEFQV 344
            ||..:.|..|:...::.    :.|.||:.    ||..|.::.|......:::..|  ::|...|:
Mouse   265 ILDLSNDCTKKNYTNIRERLLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQI 329

  Fly   345 LGTNPRILRLVHYQNKARLR 364
            : .|||||.......|.|:|
Mouse   330 I-ENPRILDSSINTLKTRIR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf5NP_650693.1 None
Mterf1bNP_001036135.2 mTERF 60..373 CDD:367120 64/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.