DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf5 and mterf1

DIOPT Version :9

Sequence 1:NP_650693.1 Gene:mTerf5 / 42182 FlyBaseID:FBgn0038584 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_003200550.2 Gene:mterf1 / 100536997 -ID:- Length:393 Species:Danio rerio


Alignment Length:386 Identity:81/386 - (20%)
Similarity:148/386 - (38%) Gaps:80/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSKRVSSKKEDLKPKLPKPPTVEIPMEEPLNASYLSKTLGSSYRSWAAALEKHPEL--KTLKRKD 87
            :|:..||..:::.|.......:|       :.|.|...|.|:.|       :||.:  :.|..:.
Zfish    49 ASRLCSSSPQNVDPAAENKCLLE-------SLSSLGVDLSSARR-------RHPGVLKRALTNEQ 99

  Fly    88 LLSSYDTLKSLD-YSVDDIIAK-PMIIYYGATTLANRHSVLQECGFHNVTVQTLAKYVTVVNKPI 150
            .|:.:...|..| .:|..||:: |..|...:..|..|.|:.:.      ..|:..:.|.::::..
Zfish   100 GLARFLQSKGADAAAVASIISRFPRCITRSSKHLQERWSLWRS------IFQSDGEMVEILSRSP 158

  Fly   151 EVLKAHNYIPFDVKVAERLAGYFKDIKL-PVDLRELESETLTLKSLRQSL-INAYLRERLQM--- 210
            |..    :...|.|..|....:.|.:.: |.||..|  .|...::...|: :|..:.|.||.   
Zfish   159 ESF----FRSSDNKNLEENITFLKSLGITPKDLHRL--LTTAPRTFSNSVALNRNMVELLQSVCA 217

  Fly   211 ---DDND-------LQKLWRVYTRIRHKSFRAVQDTIELLTKE-------------------FNF 246
               .||:       :.|  .:|..||  |...::..::.|..|                   .:.
Zfish   218 SLGGDNEKEFARIIISK--NLYIFIR--STNRIRANVDFLLSEMKLSDSEAQVFLQSHGALILDL 278

  Fly   247 SAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILMSTCDSLKQTLQHVHAFGIS 311
            |.|.|:||       ..|:|..||.: ....:|:|::..:...:|..:...|...|......||:
Zfish   279 SHESLKKN-------FQNLRLKLRSL-GCGEEDLRKMILKFSLVLFMSAQLLNTKLDCFLDAGIN 335

  Fly   312 EDAVLRCLEVLTLGPDTVLERLRDLQEIE-EFQVLGTNPRILRLVHYQNKARLRLDYLNQL 371
            ...::...:||....:.:..||..|:.:: :||..|.....:....:|.|.| ||:  |:|
Zfish   336 IQQLILKPKVLDFSVENIRRRLEQLRALDYDFQKQGIAVLDMSNKRFQEKIR-RLE--NEL 393



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.