DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7183 and CG14965

DIOPT Version :9

Sequence 1:NP_001262701.1 Gene:CG7183 / 42181 FlyBaseID:FBgn0038583 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_647783.3 Gene:CG14965 / 38388 FlyBaseID:FBgn0035414 Length:557 Species:Drosophila melanogaster


Alignment Length:477 Identity:92/477 - (19%)
Similarity:169/477 - (35%) Gaps:139/477 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ELLRKQHEVRVAKATKASAADFRPTKSAGNKEKSSDQGYKKVASSDDGAKVYEAEDHAQLEKSRR 85
            |:|..:.|..|....|.:.|....|.|  ....:..|....:.|              ||:.|..
  Fly   163 EVLATEQEQPVVHTEKTTVAHKSSTTS--TSASAMPQNILDIIS--------------QLQPSLG 211

  Fly    86 ILEAKSKFYDR-MSRNGGSLNSDDNCLVMFNRK--KQEADREPEQCTQRRESRQRLSSSSSSSQD 147
            |     |...| :.|..||    :|.|.....:  |::.|...:..|..:||.:::.|.|     
  Fly   212 I-----KLIKRPVKRQSGS----ENELFQLEEQLPKEQTDDTSKMRTVTKESEKQIKSKS----- 262

  Fly   148 EEGHDDLEVEYVDCLGRTRKCLRKDLKEAKRRDKQLAESMPERLD-QTKANWMINTKGSRELNSN 211
                                |:...:|..|..||...:.:|.|.: :.....::..:|.:|.:::
  Fly   263 --------------------CIIDVMKMPKLADKCQEKQVPTRKEYRPIKGTVVRKRGMQEADAD 307

  Fly   212 HNSDDESFIGPRPTESVFSEALSTMTKHDEQRMNWERKEQENFEKPDVH--------------YQ 262
            ..::|||                  ||...::    ||..:..:|.|.|              .|
  Fly   308 RLNEDES------------------TKEQAKK----RKLPQEAQKTDSHASPENGTILNRYTQLQ 350

  Fly   263 DVFFDEARTHGVGYYAFSTDEDERRQQQLDLEKARQATKAKQMRRDELRAQRDRLVADRVLAAKN 327
            :.|:||.:|..:        |...:..|::|..:::.:::..: .:.|......|..:..|:..:
  Fly   351 EKFWDEQKTPML--------EKPTQSIQINLSSSKENSQSDSI-SETLSESFLNLEENIPLSTDS 406

  Fly   328 RIRERNGLPPISEEDYLREE--------QQKKDELAKEEAELNRAEQE--------RRAAIERKK 376
            .........|.|.||..|::        |.:.::|::|.|:|.|.:.|        :..|:...|
  Fly   407 EDESEPDEKPSSSEDAHRDKLLQEYDKLQAEFEKLSEENAKLKRLQAESPWTSAAIKPTALSLSK 471

  Fly   377 EKEEAELEE---------LRKE-----HVRDWDKNKPGVRKLADSESAEPPEEEWKYKAE----R 423
            .:....:::         ||.|     ..|.|   |...|:.| :|..:..:|.:||..:    |
  Fly   472 PQLYMAIKKYVGPTMAALLRMEMFGGSEERTW---KDDEREFA-TELLQLGDEVYKYCCDEWRFR 532

  Fly   424 LPMSQ--EEWNEKQRAQRHAEF 443
            ||..:  ..|.||:..:...||
  Fly   533 LPSMRIARSWLEKKNTENSEEF 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7183NP_001262701.1 DUF4078 248..328 CDD:290039 16/93 (17%)
CG14965NP_647783.3 THAP 5..86 CDD:214951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28PWN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.