DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7988 and BER1

DIOPT Version :9

Sequence 1:NP_650691.1 Gene:CG7988 / 42180 FlyBaseID:FBgn0038582 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_013516.1 Gene:BER1 / 851130 SGDID:S000004404 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:43/171 - (25%)
Similarity:78/171 - (45%) Gaps:29/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MEALQQQLEGIRKPLERIVCLGLGPFSRTYHALHQAAFVIGLHRHHKIRE------ALYFDPVFR 125
            :|.||..|..|:|    |.|:.:|.|...:.|.:|.|.::.:..:.|..:      :|| ||:|.
Yeast    44 LENLQPHLNNIKK----IRCVAIGNFKEDFPATYQFALLLEITDYIKSEDERDVVVSLY-DPIFT 103

  Fly   126 DSEKELIRLFDGCIMSKDCAGKHEAT--VPTLYYLPHCPYALMHNILWSNWKRETLPNVFLISNS 188
            ..|.:.::......:.::...:::|.  ...||:|||.|..|..|||.|.     .|:::|.:| 
Yeast   104 KEEIQYLKSLGSKWLIEEEFSENDAIDYESVLYFLPHAPLDLTENILSSQ-----RPHLWLANN- 162

  Fly   189 FEMLTMTPR-------NQDDHITRIVEHC-TETPLEDDYEH 221
              |::.|.|       ....:::::|.:. |..|.|....|
Yeast   163 --MISHTDRYTKAKLCENYPNLSKLVHYLQTNAPPEVKKAH 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7988NP_650691.1 SRR1 84..133 CDD:285259 14/54 (26%)
SRR1 <120..233 CDD:297869 27/112 (24%)
BER1NP_013516.1 SRR1 57..113 CDD:400373 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104590
Panther 1 1.100 - - LDO PTHR28626
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2302
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.