DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7988 and SRR1

DIOPT Version :9

Sequence 1:NP_650691.1 Gene:CG7988 / 42180 FlyBaseID:FBgn0038582 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_200764.1 Gene:SRR1 / 836075 AraportID:AT5G59560 Length:275 Species:Arabidopsis thaliana


Alignment Length:273 Identity:63/273 - (23%)
Similarity:114/273 - (41%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNSGEDFQVVTRKKWMARKCLRRRDRHKSESD-----YLIDCPDVNVEKFQPRLE---NLCTEMC 58
            |:|..:::||...|  .|:..||:.:.|.:::     :..|..:::.:: |.||:   .:..:..
plant     8 SSSDGEWKVVLPSK--GRQGRRRKPKPKGQAEEEEQPWKSDDLEIDPQR-QARLKQKMEISLKKI 69

  Fly    59 QSDYFLVAMEALQQQLEGIRKP--------------LERIVCLGLGPFSRTYHALHQAAFVIGLH 109
            :|..|..|.      ||.::.|              ..::|..|:|..........|.:..|.:.
plant    70 ESSSFYTAF------LEQLKSPEVSNQIRLVLGSETQLQMVMYGIGSIESYESPRFQLSIAILMK 128

  Fly   110 RHHK-IREAL-YFDPVFRDSEKELIRLFDGCIMSKDCAGKHEATVPTLYYLPHCPYALMHNILWS 172
            |... :.:.: .||||...:|...:......::|.:...:.||..|||:::|||...|..|:|.:
plant   129 REFDWVGDNIEVFDPVLSATESSYLESLGCSVLSVNEQARREALKPTLFFMPHCEANLYSNLLQA 193

  Fly   173 NWKRETLPNVFLISNSFEMLTMTPRNQDDHIT----------RIV-------EHCTETPLEDDYE 220
            ||:.:.|..:.|..|||:|       .::.::          ||:       |...||. .||| 
plant   194 NWRMDRLSKIALFGNSFQM-------YEEQVSFDAEVICATKRIIAAQRVTSEFAIETE-SDDY- 249

  Fly   221 HHNVFNDLSLHTF 233
             ...|:|.|.|.|
plant   250 -FAAFHDSSWHFF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7988NP_650691.1 SRR1 84..133 CDD:285259 11/50 (22%)
SRR1 <120..233 CDD:297869 37/129 (29%)
SRR1NP_200764.1 PLN03093 1..274 CDD:178641 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3131
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590454at2759
OrthoFinder 1 1.000 - - FOG0005672
OrthoInspector 1 1.000 - - oto3480
orthoMCL 1 0.900 - - OOG6_104590
Panther 1 1.100 - - LDO PTHR28626
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.