DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7988 and Srrd

DIOPT Version :9

Sequence 1:NP_650691.1 Gene:CG7988 / 42180 FlyBaseID:FBgn0038582 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001346317.1 Gene:Srrd / 70118 MGIID:1917368 Length:350 Species:Mus musculus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:122/268 - (45%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DFQVVTRKKWMARKCLRRRDRHKSESDYLIDCPDVNVEKFQPRLENLCTEMCQSDYFLVAMEALQ 71
            |.:.|.|:...|.:.||..|...|..:.:.:|....:|:.||..|.|......|.....:.|.|.
Mouse    38 DGEAVLRRLREAEEDLRISDFCSSALETITECLRKQLEQLQPLTEALGRLHLGSSLPSASQEPLA 102

  Fly    72 QQLEGIRKPLERIVCLGLGPFSRTYHALHQAAFVI------GLHRHHKIREALYFDPVFRDSEKE 130
            .....:     :.||.|||.|:....|..|.||::      .:.|.|    ...:||:|..:|..
Mouse   103 SSASHV-----KCVCYGLGTFASCPTARIQLAFMLLFLEKCQVPRSH----CWVYDPLFSQTEVS 158

  Fly   131 LIRLFDGCIMSKDCAGKHEAT-VPTLYYLPHCPYALMHNILWSNWKRETLPNVFLISNSF----- 189
            ::......::|::..||.... .||::|:|||..||.:|:|||||..:.|..|.:|.|||     
Mouse   159 VLTSLGVTVLSENEEGKRSVQGQPTVFYMPHCGTALYNNLLWSNWSADALSRVLIIGNSFRGLEE 223

  Fly   190 EMLTMTPRNQDDHITRIVEHCTETPLEDDYEHHNVFNDLSLHTFP---QESLPG----SNDEAFW 247
            .:|....:....:|.:|::...|.||....::.:.|||.|:|.||   .|.|||    |.:|..:
Mouse   224 RLLARILQENYPYIAKILKGLEEVPLPQTPQYTDTFNDTSVHWFPLLKLEGLPGDLWASQEEPDY 288

  Fly   248 TRCAPLKV 255
            ..|..|::
Mouse   289 QDCEDLEI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7988NP_650691.1 SRR1 84..133 CDD:285259 16/54 (30%)
SRR1 <120..233 CDD:297869 38/118 (32%)
SrrdNP_001346317.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 1/1 (100%)
SRR1 <111..>225 CDD:323640 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3131
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H33447
Inparanoid 1 1.050 78 1.000 Inparanoid score I5223
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005672
OrthoInspector 1 1.000 - - oto95413
orthoMCL 1 0.900 - - OOG6_104590
Panther 1 1.100 - - LDO PTHR28626
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2302
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.