DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7988 and Srrd

DIOPT Version :9

Sequence 1:NP_650691.1 Gene:CG7988 / 42180 FlyBaseID:FBgn0038582 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001292083.1 Gene:Srrd / 288717 RGDID:1562579 Length:306 Species:Rattus norvegicus


Alignment Length:309 Identity:83/309 - (26%)
Similarity:134/309 - (43%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTRKKWMA-----RKCLRRRDRHKSESDYLIDCPDVNVEKFQPRLENLCTEMCQSDYFLVAM-- 67
            |...::|.|     ::...||.|...|....   |:.:.|....||.....::..||:...|:  
  Rat     5 VAASERWSAVARRRKRAAGRRPRQGEEPQAE---PEADSEAVLRRLLEAEEDLRISDFCSSALET 66

  Fly    68 --EALQQQLE-------------------GIRKPLE------RIVCLGLGPFSRTYHALHQAAFV 105
              |.|::|||                   |..:||.      :.||.|||.|:....|..|.||:
  Rat    67 ITECLRKQLEQLQSLTEALGRLHLGSSPGGSGEPLALSTSNVKCVCYGLGTFASCPAARIQLAFL 131

  Fly   106 I------GLHRHHKIREALYFDPVFRDSEKELIRLFDGCIMSKDCAGKHEA-TVPTLYYLPHCPY 163
            :      .:.|.|    ...:||:|..:|..::......::|::..|||.. :.||::|:|||..
  Rat   132 LLFLEKCQIPRSH----CWVYDPLFSQTEVSVLTSLGVTVLSENEEGKHSVQSQPTVFYMPHCGT 192

  Fly   164 ALMHNILWSNWKRETLPNVFLISNSFE-----MLTMTPRNQDDHITRIVEHCTETPLEDDYEHHN 223
            ||.:|:|||||..:.|..|.:|.|||:     :|....:....:|.:|::...|.||....::.:
  Rat   193 ALYNNLLWSNWSADALSRVVIIGNSFQGLEERLLARILQENYSYIAKILKGLEEFPLPQTPQYTD 257

  Fly   224 VFNDLSLHTFP-------QESLPGSNDEAFWTRCAPLKVNEDELITETE 265
            .|||.|:|.||       .|.|..|.:|..:..|..|::......|:.|
  Rat   258 TFNDTSVHWFPLLKLEGLSEDLWASREEPDYQNCEDLEIIRKPTATQLE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7988NP_650691.1 SRR1 84..133 CDD:285259 16/54 (30%)
SRR1 <120..233 CDD:297869 39/118 (33%)
SrrdNP_001292083.1 SRR1 <111..267 CDD:297869 51/159 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H33447
Inparanoid 1 1.050 76 1.000 Inparanoid score I5167
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590454at2759
OrthoFinder 1 1.000 - - FOG0005672
OrthoInspector 1 1.000 - - oto98900
orthoMCL 1 0.900 - - OOG6_104590
Panther 1 1.100 - - LDO PTHR28626
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.