DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB8A and Rab19

DIOPT Version :9

Sequence 1:NP_005361.2 Gene:RAB8A / 4218 HGNCID:7007 Length:207 Species:Homo sapiens
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:195 Identity:87/195 - (44%)
Similarity:130/195 - (66%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQER 69
            :|:|||::||||.|.||||::.||....:.....:|||:||.::||.::||:|||||||||||||
  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82

Human    70 FRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKE 134
            |||||.:|||.|.|:::|||||...||.|::.||..:..:.:::|..:::|||||:.::|:|..|
  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147

Human   135 RGEKLA--LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQK 197
            ...::.  :...:..||||||.|:|||:||..||.::|.:.|.......|:.:     ||..|.|
  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEEVPENT-----ITLGQGK 207

Human   198  197
              Fly   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB8ANP_005361.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 81/167 (49%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 80/164 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.