DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG18765

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:375 Identity:82/375 - (21%)
Similarity:139/375 - (37%) Gaps:71/375 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KRRSLKWE------QNVIC---KVM---------------PESVVAREAYKSDKLFRNEVQFYNT 111
            |..||:|:      :..:|   :|:               ||:|...........|..|...:..
  Fly    37 KIESLRWKWETQLAEPALCVHIQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEV 101

  Fly   112 IMPELLKFQASKTNQD------TPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHKGLSLEETQ 170
            ::|.|   :....|.|      .||..|..|......|.::     .:|:.:::..||||:...:
  Fly   102 VLPAL---EELYQNSDRIVHFGPPVIQAKLKSSHIYGDYIL-----NKGYSVANGLKGLSVTAME 158

  Fly   171 SVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYY-----ERLTKNAIQMVS 230
            .||.::|..|..:.||..:.|.:...| ..:.|.......|:..::.|     |.|..|..:...
  Fly   159 GVLSKLAAYHAGTAAYIAKTPGKIREL-PKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYE 222

  Fly   231 EVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVA 295
            :.:....|||.:..:..:|.:.|             :.|.:|.||.||.|...|...  .|.:..
  Fly   223 DKVKSFQKYVKSGTEILDSKTSF-------------NVILNGSCWPNNLLLQVDAFG--NVKDTL 272

  Fly   296 LLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL 360
            ...|...:|.....|:.:.|  .|....:.::....:|.|.::|...|     ||.........|
  Fly   273 FSGFHTAQYGPAVYDLFSSL--LTAPAEKSSRFDGYVKFYHDQLIENL-----NLLKFLGKKPSL 330

  Fly   361 QDLFAEELKTYGRFALGLALDILPI--STCSSEDAPDMYLDRSDELGEDV 408
            .||..:.|| ||.:|...|.:||||  |...:.|..:::  |:...||.:
  Fly   331 TDLQLDLLK-YGHWAFETATEILPIVLSDFGNNDIEELF--RNPVFGEQI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 62/309 (20%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 59/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.