DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG31087

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:405 Identity:103/405 - (25%)
Similarity:173/405 - (42%) Gaps:72/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTTGLGAANAVESKQI------LSLEVFQDIFKHVEPDVQIDAFEL------AQGSDRGDNYTAA 62
            ||.|   .|.|.:..:      :|||      |.|:  .||..||.      .:||..||||:..
  Fly     5 TTNG---HNEVPANNLPSWLSKISLE------KAVQ--AQIGDFEKIISVIPQKGSSDGDNYSTQ 58

  Fly    63 LYRIKLTGK--RRSLKWEQNVICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTN 125
            ..|:.:..:  ..|.| :.:.:.|....:.:........|||:.|.|.|::|:|   ||:....:
  Fly    59 FLRLLVEVELIDHSTK-DLSFVLKAQHSNEMMAAILAKLKLFQKEEQMYHSILP---KFEKLYAD 119

  Fly   126 QDTPVFNAIPKCYSARHDL----LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAY 186
            ...|:..| ||.:....||    :::|||..:.|:.::|..||.|:....||.::|..|..|..|
  Fly   120 AGKPIQFA-PKAFKFDRDLGVDYILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACY 183

  Fly   187 KFEKPL---EFSNLCSMISEGIFCTANTSWYRNYYE--------RLTKNAIQMVSEVLPPDSKYV 240
            .....|   ||       :.|:|..:|....:.:..        :..||| |.:.|.|.....|:
  Fly   184 VEHHGLFGEEF-------TVGVFSESNRQLLQEFNASGAFLAQLKKWKNA-QKIYEKLADSDDYL 240

  Fly   241 LAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYS 305
              :::..:...:..|         ..:.:.|||||.||.:|.:|...  .:.|...:|||:.:|.
  Fly   241 --VDRLLQDQQYNTR---------EFNVLNHGDCWANNVMYQHDAFG--TIKETLFVDFQVGKYG 292

  Fly   306 SIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKT 370
            |.|.|:..|:......|::.|:...|::.|.:.|...|::|..:.|     |.||::|.|...:.
  Fly   293 SPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLKLLQYHRP-----LPKLKNLHASLFRN 352

  Fly   371 YGRFALGLALDILPI 385
             |..|..:...:||:
  Fly   353 -GLAAYMVVSKVLPV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 76/306 (25%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 77/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.