DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG10550

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:391 Identity:97/391 - (24%)
Similarity:171/391 - (43%) Gaps:66/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EVFQDIFKHVEPDVQ-----IDAFELAQGSDRGDNYTAALYR--IKLTGKRRSLKWEQNV--ICK 84
            |.||.|   :|.||:     |:...:| .:..|:|||:.:.|  :.:..|..|   ||.|  |.|
  Fly    26 EYFQPI---IEKDVENFDKIINLVPIA-ATAPGENYTSIMIRVIVDILLKDGS---EQRVSYILK 83

  Fly    85 VMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKC--YSARHDLLIM 147
            .|.|:....:......||..|.:.|...:|:.:|.......:    ....|||  ..|..:|:.|
  Fly    84 TMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLE----IELAPKCLHVDATDELITM 144

  Fly   148 --EDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLS-LAYKFEKPLEFSNLCSMISEGIFCTA 209
              |||..:.|:..||.||..|...:.||.::|:||..| :|.:...|.:     :|.:..|:   
  Fly   145 VFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYD-----AMYNMSIY--- 201

  Fly   210 NTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKF--AESSSFFGRM----------VKLAST 262
             ....|:.:|.|.|..          :.:::.||..:  ..:.|:..||          |::...
  Fly   202 -NEQSRDLFESLGKQR----------EEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQV 255

  Fly   263 -ESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDA 326
             |...:.:.|||||.||.:::|  :|...:....|:|.|:.::.|.|.|:..|:....:.:::..
  Fly   256 DEDEFNVLNHGDCWSNNIMFNY--KDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIK 318

  Fly   327 QLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPISTCSSE 391
            :....::||.:.|...|::|..:.|     :..|:||....|| ||.:....|:.:: ::|....
  Fly   319 EFDHFIQIYHQRLAECLKLLNYSKP-----IPTLRDLHIMMLK-YGFWGPLTAMGVM-VATLMPT 376

  Fly   392 D 392
            |
  Fly   377 D 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 76/311 (24%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 77/314 (25%)
APH 108..338 CDD:279908 59/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.