DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG13659

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:395 Identity:90/395 - (22%)
Similarity:167/395 - (42%) Gaps:77/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSLEVFQDIFKHVEPDVQIDAFELA--QGSDRGDNYTAALYRIKLTGKRRSLKWEQNVICKVM-P 87
            |:::....:.:..|.|..:....|:  ..|.:||:|.:.::|.::....::..:.:::|.|.| .
  Fly    17 LNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEYTAQNGNFTKSLIIKTMIV 81

  Fly    88 ESVVAREAYKSDKLFRNEVQFYNTIMPE---LLKFQASKTNQDTPVFNAIPKC--YSAR-HDLLI 146
            |..:.::.:|...||..|:..|..::||   :|:    :.|....::   .:|  :|.: |.:||
  Fly    82 EEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILR----RANDPAKLY---VECIYHSLQPHQILI 139

  Fly   147 MEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFSN-LC--------S 199
            .:||.|.|:.:. |.:.|:.||..|...::|::|.:|:.:..|:|   .||.| ||        |
  Fly   140 FDDLVEMGYAVV-RDRFLTREEISSAYSKLAKIHAISMKFIHEQPEYLKEFKNGLCEMPGLIDSS 203

  Fly   200 MISEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGR----MVKLA 260
            :||.|:         ..:.|.|.:         :|..|||.....|.  |..|..|    |.:..
  Fly   204 IISGGM---------DPFMEMLGR---------IPELSKYQPHFKKI--SLHFKDRLRETMQEYR 248

  Fly   261 STESP-LSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMR 324
            :...| .:.:||.|....|.::..:.| .....:..|||:|....:.:|:|:...:|.......|
  Fly   249 NNPQPGYNVLCHADFHSRNMMFKNNKE-TGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQR 312

  Fly   325 DAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL--------QDLFAEELKTYGRFALGLALD 381
            ..:|..||..|...|.              :||:|:        :..|..|:|.:..:...|...
  Fly   313 REELDILLNYYLSILL--------------ETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLST 363

  Fly   382 ILPIS 386
            .||:|
  Fly   364 FLPVS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 75/313 (24%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 78/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.