DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG11893

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:375 Identity:83/375 - (22%)
Similarity:163/375 - (43%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANAVESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79
            |:.:|:...|:.:...|:.:..|  |::::...::...|.:||:|.:.::|..........|:.:
  Fly    12 ADELEAPAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFCK 76

  Fly    80 NVICKVMPESVVAREAYKSD-----KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYS 139
            .:|.|.|||    :|.:|.|     .||..|:..|...:||..:. ..:...||.:|  :|..| 
  Fly    77 PLIIKTMPE----QEGHKKDMLSDSHLFSTEINAYTKALPEFERI-LREAGDDTKLF--VPCIY- 133

  Fly   140 ARHDL-----LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFS- 195
              |.|     ||.|||..:|:.:. |.:.:::.|.::|..::|:.|.:|:....|:|   .:|. 
  Fly   134 --HSLEPRQVLIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKY 195

  Fly   196 ---NLCSMISEGIFCTANTSW------------YRNYYERLTKNAIQMVSEVLPPDSKYVLAMNK 245
               .:.|::|:.:..|...::            |:.::|::.:|.||.:.:|:....|.|     
  Fly   196 GLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNV----- 255

  Fly   246 FAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALD 310
              :|..::              .:||||....|.:::.:.       ||..:|||:.....|.:|
  Fly   256 --QSDGYY--------------VMCHGDFHGRNMMFNKNE-------EVMFVDFQICNLCPITID 297

  Fly   311 IANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL 360
            ::..:|.....|.|....:.|:..|    |..|:          |||:|:
  Fly   298 LSYSVYMLMEPEQRWDLGKDLINFY----FSVLE----------DTLKKV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 72/318 (23%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 76/335 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.