DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG13658

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:392 Identity:89/392 - (22%)
Similarity:162/392 - (41%) Gaps:94/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANAVESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79
            |:.|::...|:.|:.:...:..|  |::.:...:::..:.:||:|.:.::|...........:.:
  Fly    12 ADEVDAPAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSK 76

  Fly    80 NVICKVMPESVVAREAYKSDKL-----FRNEVQFYNTIMPEL---LKFQASKTNQDTP-VFNAIP 135
            .:|.|.|||    :|.:|.|.|     |:.|:..|:..:|||   |:.....|....| :::::.
  Fly    77 ALIVKTMPE----QEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLE 137

  Fly   136 KCYSARHDLLIMEDLRERGFQ-MSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFS- 195
            .     |.::|.|||..:|:. :.||:.  :.||.|....::|:.|..|:....|:|   .||. 
  Fly   138 P-----HQVMIFEDLVPQGYTVIRDRYP--NKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKY 195

  Fly   196 ------NLC--SMISEGIFC-------TANTSWYRNYYERLTKNAIQMVSEVL-------PPDSK 238
                  |..  |:::.|:.|       ....:.|:.|:|::..|.||.:|.|:       .|:..
  Fly   196 GLWGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRY 260

  Fly   239 YVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIR 303
            |||                            ||||....|.::.|:.| .....:|.|:|||:..
  Fly   261 YVL----------------------------CHGDFHGRNMMFRYNKE-TGSFEDVMLVDFQISN 296

  Fly   304 YSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEEL 368
            ...:::|:...::.....|.|    ..|.|.|....|..|          .|||:|:.  |..|:
  Fly   297 VCPLSIDLIYSIFMVMDTEDR----WDLGKEYINYYFSVL----------ADTLKKIG--FKGEM 345

  Fly   369 KT 370
            .|
  Fly   346 PT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 76/325 (23%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 80/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.