DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG31104

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:404 Identity:85/404 - (21%)
Similarity:175/404 - (43%) Gaps:79/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANAVESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79
            |:.:::...|:.:...||.:..|  ||:::...:::..:.:||:|.:.::|.|:.......|:.:
  Fly    10 ADELQAPAWLNAQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFK 74

  Fly    80 NVICKVMPESVVAREAYKSD-----KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYS 139
            .:|.|.|||    :|.:|.|     .||..|:..|...:||..:. ..:...:|.:|  :|..| 
  Fly    75 PLIIKTMPE----QEGHKKDMLSESHLFETEIGMYCHALPEFERI-LREAGDNTKLF--VPCIY- 131

  Fly   140 ARHDL-----LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPL---EFS- 195
              |.|     :|.|||..:|:.:. |....||.:.:....::|:.|.:|:....|:|.   ||. 
  Fly   132 --HSLKPRQVMIFEDLVPQGYTVI-RDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQY 193

  Fly   196 ---NLCSMISEGIFCTANTSW------------YRNYYERLTKNAIQMVSEVLPPDSKYVLAMNK 245
               .:.::.::....|..|::            |::::|::..|.:|.:...:   .:|    :|
  Fly   194 GLFEMPTIDTDPFITTGMTNFIEMLDKMPELRKYKHHFEKIKDNYMQRLEVEM---HEY----HK 251

  Fly   246 FAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPE----DPHRVLEVALLDFQLIRYSS 306
            :..:..::              .:||||..:.|.::.::.|    |     :|.|:||||.....
  Fly   252 YRRNDRYY--------------VLCHGDFHLRNMMFRHNKELGAYD-----DVMLVDFQLSNLCP 297

  Fly   307 IALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQML--CTNLPDHCDTLQKLQDLFAEELK 369
            |.:|:...:|.....|.|....:.|:..|...|...|:.:  ..::|...:..:::|:     .|
  Fly   298 ITVDLTYSVYMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQN-----NK 357

  Fly   370 TYGRFALGLALDIL 383
            .|..|.:...|.|:
  Fly   358 YYDFFLISTFLPIM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 71/322 (22%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 71/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.