DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG13813

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:393 Identity:99/393 - (25%)
Similarity:170/393 - (43%) Gaps:65/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYS----AR 141
            |:.|:.|.:...|........:..||..|..:.|   .|:|...:::|  |...|...:    |.
  Fly    55 VVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFP---VFRALSPDRNT--FTVAPALQANDLKAP 114

  Fly   142 HDLLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIF 206
            .:.||.|||.|.||:.:.|....:.:.....|..:|:||..|...:...||:|..|...:.:...
  Fly   115 DEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNL 179

  Fly   207 CTANTSWYRNYYERLT----KNAIQMVSEVL-PPDSKYVLAMNKFAESSSFFGRMVKLA------ 260
            .|::       .|.:|    |..::....:| ..|...|.|:.:..:...  .::..||      
  Fly   180 FTSD-------IEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCE--NQLKSLALYCVDG 235

  Fly   261 STESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRD 325
            ..::|.:.|||||.|.||.||.::|.....| |..|:|||:.||:...|||.:.|:.||.|.:||
  Fly   236 KAQAPHAVICHGDFWNNNILYRHEPNSDQPV-EAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRD 299

  Fly   326 AQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL--QDLFAEELKTYGRFALGL---------- 378
            ......:..|...:.:.|:. | ||     :|:.:  :.:|..:|:.||.:.|.:          
  Fly   300 EHFPDFMDAYYNTMDQKLKS-C-NL-----SLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFIS 357

  Fly   379 -ALDILPISTCS--------SEDAPDMYLDRSDELGEDVGAPTLNFPPNDLCRQKMSEIVIDMVD 434
             |.:::.|.|.|        |.|.| .|.:..:|. |.:.|.||     .:.:::::.||.|::.
  Fly   358 NANEVIDIDTVSEAIQSISTSSDEP-KYKELIEEY-EMLNARTL-----PIFKRRITGIVEDLIK 415

  Fly   435 RDM 437
            .:|
  Fly   416 YNM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 73/279 (26%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 1 1.000 - - FOG0002485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.