DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and E02C12.19

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001343835.1 Gene:E02C12.19 / 34700618 WormBaseID:WBGene00271797 Length:185 Species:Caenorhabditis elegans


Alignment Length:111 Identity:27/111 - (24%)
Similarity:46/111 - (41%) Gaps:31/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFA-ESSSFFGRMVKLASTESP 265
            |:||..|..|          .:|..:.:.:....::|:  ..||.| ..|:..|.|        |
 Worm     7 SDGILKTHVT----------RENVEETLQKTFNTEAKF--GDNKNAINISNMKGYM--------P 51

  Fly   266 LSAICHGDCWVNNFLYHYDPEDPHRV-----LEVALLDF-QLIRYS 305
            ::|:...| |||.   ..|.:.|.|.     .:|.||:. ::|::|
 Worm    52 INALIEVD-WVNK---EEDRQLPSRFAVKISTQVPLLELSKIIKFS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 27/111 (24%)
E02C12.19NP_001343835.1 PKc_like 3..>164 CDD:328722 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.