DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG33509

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:377 Identity:80/377 - (21%)
Similarity:139/377 - (36%) Gaps:91/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GDNYTAALYRIKLTGKRRSLKWEQNVICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQ 120
            ||.|...|   :...:...:..|..:..|.||:.  :.|..| :.:|:.|...|:|::.:|....
  Fly    39 GDYYALTL---RYCHEEEEIIREIELFVKAMPQQ--SAELSK-ESIFQKESWLYDTLIKKLQALS 97

  Fly   121 ASKTNQDTPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHKGLSLEE--TQSVLLQVAQLHGLS 183
            ..|.:         |.|..:|.||:::|:::.:||..:.   ...|.|  .:.::..:|..|..|
  Fly    98 NVKWS---------PNCVYSRKDLMVLENIKLKGFTSAG---SAELNEVFVKPLIKSIAAFHSAS 150

  Fly   184 LAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAE 248
            |.|:.:......:........|...:..:|:        ...:..|..|:...:||     :...
  Fly   151 LVYEHQTKTNIGHTYGDNLLEITVDSEIAWF--------TTGLSAVLAVVRSLAKY-----QGNR 202

  Fly   249 SSSFFGRMV---------KLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRY 304
            ..||.|..:         :.|.::...:.:||.|.|..|..  :.||:....|   |:|||..||
  Fly   203 EQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIF--FPPENSGPAL---LIDFQTCRY 262

  Fly   305 SSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEE-- 367
            :..|.|:...||...:...|....:..:.:|                 |...||.|.||..||  
  Fly   263 APPASDLNFCLYMNLSSSKRKQMEKQGIDLY-----------------HTYLLQNLSDLGLEELV 310

  Fly   368 ------LKTYGRFAL------GLALDILPISTCSSEDAPDM------YLDRS 401
                  |::|..|.|      .:|..::.:.|       |.      |:|||
  Fly   311 ISKSELLESYEEFRLFGVVYRAVAATVVKVPT-------DFITNDFKYVDRS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 61/300 (20%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 61/291 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.