DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG33511

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:399 Identity:102/399 - (25%)
Similarity:173/399 - (43%) Gaps:84/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QIDAFELAQGSDRGDNYTAALYRIKLTG--KRRSLKWEQNVICKVMP-ESVVAREAYKSDKLFRN 104
            |:||     ||.....|....|::.|..  |....|:..|...|.:| ::...||..:...:|:.
  Fly    31 QVDA-----GSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQK 90

  Fly   105 EVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDLLIMEDLRE--RGFQMSDRHKGLSLE 167
            |...|:.|:|::.|:...|         ..||||.:|:|:|::|||.:  |..:.::.:   :|:
  Fly    91 ESALYSQILPKIQKYATKK---------LYPKCYYSRNDILVLEDLTQDYRHLRANEYY---TLD 143

  Fly   168 ETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWY------------RNYYER 220
            ..:.||..:::||..|:|::.::.::.......:...:...:|.|||            ||.:.:
  Fly   144 HYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQ 208

  Fly   221 LTK--NAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHY 283
            ..|  |.||        |..|.| :.|..|         .:|.:::..:.:||.|.|.:|.:|::
  Fly   209 TMKAQNFIQ--------DKLYNL-LTKAEE---------LVAPSKTIRNVLCHRDTWDHNIVYYF 255

  Fly   284 DPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCT 348
            :.|.........::||||.:|.|..||:..|||...:.|:|.|       ||.|.|..:.:    
  Fly   256 NKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRA-------IYDECLEHYYK---- 309

  Fly   349 NLPDHCDTLQKLQDLFAEE--LKTYGRFALGLALDILPISTCSSEDAP--------------DMY 397
            ||..|.|.|...::|..|.  .|...|..|. ||.|..::...::.:|              |.|
  Fly   310 NLQHHLDRLGLDKNLITENNFRKECQRTRLA-ALVIWALTEPQTKMSPSISNRLRSEEPEKFDYY 373

  Fly   398 L--DRSDEL 404
            |  |||:.|
  Fly   374 LNCDRSELL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 76/308 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 80/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.