DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG31099

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:321 Identity:84/321 - (26%)
Similarity:142/321 - (44%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KLFRNEVQFYNTIMPELLKF--QASKTNQDTPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHK 162
            |:|:.|.|.|:.::|:|.:.  :..|.....|  .|....||.....:::|||:.:.::..:|..
  Fly    85 KMFQREHQVYHNVLPKLEEIYREVGKKVSFGP--RAFRLDYSIGVQYVLLEDLKAKSYKNVERQA 147

  Fly   163 GLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYYERLTKNAIQ 227
            |.:....:.||.::||.|..| |...||...||||   :..|::..||.|               
  Fly   148 GFNKLCLKQVLKKLAQFHAAS-AVCVEKHGAFSNL---LVNGVYTKANES--------------- 193

  Fly   228 MVSEVLPPDSKYVLAMNKFAESSSFFGRMV-----------KLASTES-PLSAICHGDCWVNNFL 280
            ::.|:..|:. ::..:.::.....|..|:|           ||.|.:| ..:.:.|.||||||.:
  Fly   194 VLQELNDPEI-FLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVM 257

  Fly   281 YHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQM 345
            :.:|  |...|.:.||||:||::|.|.|:|:...:.....|:::.||...:::.|...|...|:.
  Fly   258 FKFD--DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKA 320

  Fly   346 LCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPISTCSSEDAPDMYLDRSDELGE 406
            |  |.......||.::|    .|...|..|..:....|||:         |.....||:.|
  Fly   321 L--NFGGSLPQLQHIRD----ALNKNGLAAYVVVTRALPIT---------MMNQFEDEVNE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 69/259 (27%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.