DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG2004

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:405 Identity:108/405 - (26%)
Similarity:198/405 - (48%) Gaps:31/405 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AFELAQGSDRGDNYTAALYRIKLTGKRRS------LKWEQNVICKVMPESVVAREAYKSDKLFRN 104
            :::......:||.|.:.::||.:.|.:.:      .:.|.:||.|.||:::..|..::|...|||
  Fly    33 SYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRN 97

  Fly   105 EVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSAR----HDLLIMEDLRERGFQMSDRHKGLS 165
            |:.||..::|.:..||.|:.......|...|:|.::.    :|.:.:||:..||::...|...:|
  Fly    98 EINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYIS 162

  Fly   166 LEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYY---ERLTKNAIQ 227
            ||:....:..:.:.||::||:.......|......:.|..:......||..:.   |.:..:|::
  Fly   163 LEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVK 227

  Fly   228 MVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVL 292
            .:.    |:|||......|.: ...|..::.|.||.|.||...|||||..|||..|:......  
  Fly   228 QIY----PNSKYETVATNFLQ-PPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSE-- 285

  Fly   293 EVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTL 357
            |:.::||||.|.||:|||::..:|.||::|:|:.....||:.|.|.    .|.|..:|..:.:::
  Fly   286 EIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLES----AQDLIQDLGGNAESI 346

  Fly   358 QKLQDLFAEELKTYGRFALGLALDILPISTCSSEDAPDMYLDRSDELGEDVGAPTLNFPP--NDL 420
            ...:.| .||||.:|||..|:.::.||::....::..|:...:.:.:..|:    .|..|  ...
  Fly   347 ISWESL-QEELKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDI----WNITPFKESA 406

  Fly   421 CRQKMSEIVIDMVDR 435
            .:|::::|....:|:
  Fly   407 KQQRLADIFKHAIDQ 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 88/302 (29%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 89/308 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26930
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
66.030

Return to query results.
Submit another query.