DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and CG32195

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:406 Identity:98/406 - (24%)
Similarity:169/406 - (41%) Gaps:90/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRR---SLKWEQNVI 82
            ::|.|.|.|:.......  ..::::.|.:...|.:|:|:.:.:||:.|..:|.   :|:..:.::
  Fly     3 REIYSAEYFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYIL 67

  Fly    83 CKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPK----------C 137
            ..::|.:..         |..||...:..::|.:   ||        :....||          |
  Fly    68 KDLLPAAAA---------LGTNEKDMFEVLLPAM---QA--------ILEEAPKEIGEHKLSADC 112

  Fly   138 ----YSARHDLLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLC 198
                .||..:|.|:|||...|::..||.:||:|||.:..:.::||.||.|.....:||.....| 
  Fly   113 LLVEISAGKELYILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRL- 176

  Fly   199 SMISEGIFCTANTSWYRN-----YYERL----TKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFG 254
                       :.|.|.|     :.:.|    .:.|.:..:|.||..||.:    |.....::..
  Fly   177 -----------SPSHYANGLNDRFAQALVLEGAEYAAEAFAEELPEISKKM----KAQIPKAYTK 226

  Fly   255 RMVKLAS-TESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCC 318
            ||..:.. .:|.|:|:.|||.|:||.::.:..:      :..|:|||...:.|.|:|:..|.|..
  Fly   227 RMRDVVDPNKSSLNAVIHGDPWLNNIMFDFVNK------KATLVDFQNCYWGSPAIDLYFLFYTS 285

  Fly   319 TTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHC---DTLQKLQDLFAEELKT---YGRFALG 377
            ...|:.......||..|.:.|...|:        ||   |||.....| .:|:|.   ||.:.:.
  Fly   286 LKPELLLNNQDELLNYYFDNLLETLR--------HCGYKDTLPTFGQL-KDEMKRCLFYGYYTVV 341

  Fly   378 LALDILPISTCSSEDA 393
            ..|.|    .|:|.:|
  Fly   342 CELPI----CCASPEA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 77/316 (24%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 79/327 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.