DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and nhr-246

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:338 Identity:71/338 - (21%)
Similarity:129/338 - (38%) Gaps:91/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VEPDVQIDAFELAQGSDRGDNYTAALYRIKL------TGKRRSLKWEQNVI-CKV---------- 85
            |:|  :|....:.:.|:.|  :.:.|.:::|      ..|...||..||.. |.|          
 Worm    26 VKP--KIGTVGILENSELG--FMSLLRKVRLHFDNDDLPKHVVLKIPQNTKGCSVVENAGGGVKN 86

  Fly    86 MPESVVAREAYKSDKLFRNEVQFYNTIMPELLK----FQASKTNQDTPVFNAIPKCYSARHDLLI 146
            :..|||.|..:.::   .|..:.::::..:.|:    :.|||..:..||            .:::
 Worm    87 VDHSVVERFMHNTE---CNYYKLFSSLSEKPLQIPTTYLASKAGEKAPV------------PVIV 136

  Fly   147 MEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYK-------FEKPLEFSNL--CSMIS 202
            :|.|.:  .::.|...|.:.::...::.::.:||..||..:       .|..|..|..  |.:..
 Worm   137 LEMLED--CKLHDLIPGFNEDQLFKIVDELVKLHIFSLTTEKWKEIVPDESKLAMSGFLQCMVAD 199

  Fly   203 EGIFCTANTSWYRNYYERLTKN-----AIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLAST 262
            .|              .:|.:|     .:..|...|..|..|:..|..            :..:.
 Worm   200 VG--------------RKLAQNPELGVILSYVENTLDTDPNYLQKMRD------------EYINE 238

  Fly   263 ESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVA-LLDFQLIRYSSIALDIANLLYCCTTKEMRDA 326
            |.| |.|||||.|....|  :|.||     .:| ::|:|.....|...|:.::|..||:.:.|..
 Worm   239 ERP-SVICHGDLWAPQIL--WDKED-----NIAGIVDWQATHRGSPMEDLHHILSTCTSVQNRKT 295

  Fly   327 QLQTLLKIYTEEL 339
            ..:.||..|..:|
 Worm   296 FTKPLLDHYYNKL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 67/320 (21%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 46/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.