DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and E02C12.9

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:159 Identity:32/159 - (20%)
Similarity:60/159 - (37%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 YRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNN 278
            ::..|....|.....|..::.....|...:.|:.:.|...|..          |.:.|||.|.:|
 Worm   161 FQGMYSVFEKEKYYQVDGLIETFVVYQKLLKKYTKISELLGFK----------SVLNHGDLWQSN 215

  Fly   279 FLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMR-----DAQL---QTLLKIY 335
            .:  :..|:..::...|::|:|........||.|.|:..|.:.|.|     |..|   :|.:.::
 Worm   216 MI--HSMENNGKLKLEAIIDWQSTVILPPGLDTAELIVGCLSAEDRREKGHDLLLLYHKTFINVF 278

  Fly   336 TEELFRWLQMLCTNLPDHCDTLQKLQDLF 364
            ..|:|               :.::|||.:
 Worm   279 GSEVF---------------SFEELQDSY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 29/139 (21%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 32/159 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.