DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and C29F7.1

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:387 Identity:72/387 - (18%)
Similarity:140/387 - (36%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANAVESKQILSLEVFQDIFKH---VEPDVQIDAFELAQGSDRGDNYTAALYRIKL-TGKRRSLK- 76
            :|.:.....|:.|...|:.|.   |:|  ::.:..:...:|.|  :.:.:.:::| ....:.|| 
 Worm     2 SNLIIDNYPLTKEWLADLVKKKIGVKP--KVGSCGILDNADLG--FMSMIRKVQLHFDAEQELKH 62

  Fly    77 --WEQNVICKV-----MPESV--VAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFN 132
              ..:||:.|:     :.|.|  |..:..|.:.....|:..:||   |...:...:...|.|:  
 Worm    63 PNLPKNVVIKIASCAKLGEGVGSVGVDVNKGNAAAIMELFMHNT---ECNYYNVFRKYTDLPM-- 122

  Fly   133 AIPKCYSARH--------DLLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFE 189
            .:|..|.|..        .:::||...:  ..:.|...|...::...::.::..||         
 Worm   123 KVPVIYCAAKAGDAEAPVPVIVMEMFED--CTVHDLIDGFDKDQLFKIVDEIVNLH--------- 176

  Fly   190 KPLEFSNLCSMISEGIFCTANTSWYR-----------NYYERLTKNAIQMVS-----EVLPPDSK 238
                           ||......|..           :.:|.:.|...:.::     |::   ||
 Worm   177 ---------------IFSLTTEEWRSVLPDSAMRDTVDLFEAMVKTIAENMAKSPGLEII---SK 223

  Fly   239 YVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVA-LLDFQLI 302
            |:  ...|.:..||..:...........|.:.|||.|....|  :|.:|     .:| ::|:|:.
 Worm   224 YI--EKTFDKDPSFMTKFSDEYLEGKRKSVLTHGDLWSPQIL--WDKDD-----NIAGIIDWQVG 279

  Fly   303 RYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLP----------DHC 354
            ...|...|:..:|...|:.|.|:...:.||..|.|:|...|:.....:|          :||
 Worm   280 HQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAGLEEKGVKMPWTREEVDEEYNHC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 61/325 (19%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 41/217 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.