DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and dhs-27

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:123 Identity:25/123 - (20%)
Similarity:48/123 - (39%) Gaps:24/123 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 YVLAMNKFAESSSFF--GRMV-KLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQ 300
            |:..:.|......|:  ||.: ||.:|:..| ...|| |.|...::.::.:|    |.....|.:
 Worm    64 YIEELCKTRGLKKFYLIGRNIDKLNNTKKEL-VEQHG-CEVMCHVHDFEKDD----LSALPKDLE 122

  Fly   301 LIRYSSIALDIANLLYCC--------TTKEMRDAQLQTLLKIYTEELFRWLQMLCTNL 350
                   .||:..|:.|.        |..|:.:.....:|::......:..:|:..|:
 Worm   123 -------TLDVGILINCAGIAPHIIGTLTELPEGLASKILRVNLMSAVKMTEMILPNM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 23/117 (20%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 25/123 (20%)
adh_short 50..234 CDD:278532 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.