DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14314 and F58B4.5

DIOPT Version :9

Sequence 1:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:362 Identity:81/362 - (22%)
Similarity:120/362 - (33%) Gaps:103/362 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LFRNEVQFYNTIMPE------LLKFQASKTNQDTPVFNA--IPKCYSARHDLLIMEDLRERGFQM 157
            |...||..|..:|.|      ..|..|||...|.....|  |.:.|...|.:             
 Worm   114 LHNREVATYKILMREKHPKIPFTKVYASKPFDDENKLKAYLISEYYPNIHHI------------- 165

  Fly   158 SDRHKGLSLEETQSVLLQVAQLH--GLSLA-------------------YKFEKPLEFSNLCSMI 201
             ..|:.:..|:...|:..:|...  |:.|:                   :..||.:|..|:    
 Worm   166 -GMHESIPAEDLIPVIHAIAAFSAIGMKLSEEETKYARGADFLDIVFGQFMDEKSIERMNV---- 225

  Fly   202 SEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVL---AMNKFAESSSFFGRMVKLASTE 263
                  ....|:...|.|:        |.|:|.....|..   .:..|..:..|||        .
 Worm   226 ------LLKASFPEEYLEK--------VEEMLKIYKDYYFQPQMIKNFKNTCQFFG--------Y 268

  Fly   264 SPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLL-YCCTTKEMR--- 324
            .|:  :.|.|.|.:|||...|.|   :|...|::|||.:..::.|.|:..|. .|.:||:.|   
 Worm   269 KPV--LTHSDLWSSNFLCTRDGE---KVTLKAIIDFQTVSITTPAQDVGRLFASCLSTKDRREKA 328

  Fly   325 DAQLQTLLKIYTEELFRWLQMLCTNLPDHCD---TLQKLQDLFAEELKTYGRFALGLALDILPIS 386
            |..|:.....:..||            |..|   |.|:|:|.:...........|.....:|..|
 Worm   329 DFLLEEYYNTFVNEL------------DGMDVPYTFQQLKDSYQVYFPLMTTMVLPGIAPMLQHS 381

  Fly   387 TCSSEDAPDM---YLDRSDELGEDV----GAPTLNFP 416
            ..:.|....|   .||:...|.|||    .:...|||
 Worm   382 NVTEEYKDSMKQVALDKMIGLLEDVITTHESNIKNFP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 61/280 (22%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 78/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.